Login | Register For Free | Help
Search for: (Advanced)

Mailing List Archive: Python: Python

Regular expression

 

 

Python python RSS feed   Index | Next | Previous | View Threaded


beema.shafreen at gmail

Jul 16, 2008, 7:09 AM

Post #1 of 1 (186 views)
Permalink
Regular expression

Hi all,

How do I write a regular expression for this kind of sequences

>gi|158028609|gb|ABW08583.1| CG8385-PF, isoform F [Drosophila melanogaster]
MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE

thanks

--
Beema Shafreen

Python python RSS feed   Index | Next | Previous | View Threaded
 
 


Interested in having your list archived? Contact Gossamer Threads
 
  Web Applications & Managed Hosting Powered by Gossamer Threads Inc.